HORDB

ID: hor000978
Uniprot ID: P01351
Protein name: Gastrin
Gene name: GAST
Organism: Sus scrofa (Pig)
Family: Gastrin/cholecystokinin family
Source: animal
Expression: cerebral cortex and duodenal mucosa
Disease: NA
Comments: NA
Taxonomy: Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007186 G protein-coupled receptor signaling pathway; GO:0032094 response to food
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: QGPWMEEEEEAYGWMDF
Length: 17
Propeptide: MQRLCAYVLIHVLALAACSEASWKPGFQLQDASSGPGANRGKEPHELDRLGPASHHRRQLGLQGPPHLVADLAKKQGPWMEEEEEAYGWMDFGRRSAEEGDQRP
Signal peptide: MQRLCAYVLIHVLALAACSEA
Modification: T1 Pyrrolidone carboxylic acid;T12 Sulfotyrosine;T17 Phenylalanine amide
Glycosylation: NA
Mutagenesis: NA

Function: Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine.
Mechanism: NA
Cross BBB: NA
Target: CCKBR
Target Unid: A0A287A2K5
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor000978_AF2.pdb

hor000978_ESM.pdb

Mass:	241984	Formula:	C96H124N20O32S2
Absent amino acids:	CHIKLNRSTV	Common amino acids:	E
pI:	3.19	Basic residues:	0
Polar residues:	3	Hydrophobic residues:	4
Hydrophobicity:	-127.06	Boman Index:	-3242
Half-Life:	0.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	5.88
Instability Index:	11011.18	Extinction Coefficient cystines:	12490
Absorbance 280nm:	780.63