General Information

  • ID:  hor000978
  • Uniprot ID:  P01351
  • Protein name:  Gastrin
  • Gene name:  GAST
  • Organism:  Sus scrofa (Pig)
  • Family:  Gastrin/cholecystokinin family
  • Source:  Animal
  • Expression:  cerebral cortex and duodenal mucosa
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0032094 response to food
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QGPWMEEEEEAYGWMDF
  • Length:  17(76-92)
  • Propeptide:  MQRLCAYVLIHVLALAACSEASWKPGFQLQDASSGPGANRGKEPHELDRLGPASHHRRQLGLQGPPHLVADLAKKQGPWMEEEEEAYGWMDFGRRSAEEGDQRP
  • Signal peptide:  MQRLCAYVLIHVLALAACSEA
  • Modification:  T1 Pyrrolidone carboxylic acid;T12 Sulfotyrosine;T17 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  CCKBR
  • Target Unid:   A0A287A2K5
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01351-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000978_AF2.pdbhor000978_ESM.pdb

Physical Information

Mass: 241984 Formula: C96H124N20O32S2
Absent amino acids: CHIKLNRSTV Common amino acids: E
pI: 3.19 Basic residues: 0
Polar residues: 3 Hydrophobic residues: 4
Hydrophobicity: -127.06 Boman Index: -3242
Half-Life / Aliphatic Index: 0.8 hour Aliphatic Index: 5.88
Instability Index: 11011.18 Extinction Coefficient cystines: 12490
Absorbance 280nm: 780.63

Literature

  • PubMed ID:  14248711
  • Title:  The antral hormone gastrin. Structure of gastrin.